Collection: Catalogue peptides
Purified peptides ready to ship worldwide from our UK ISO 9001 certified laboratory.
Supplied lyophilised in amounts ranging from 0.5mg to 5mg at > 95% purity with HPLC and mass spec chromatograms.
Our bioactive peptides include histone peptides and arrays, Epstein-Barr virus peptides (EBVs), Influenza peptides, Cytomegalovirus peptides (CMV), cell-penetrating peptides (CPPs), and many others used in different applications such as HIV, diabetes and cancer research.
We are constantly adding to our extensive peptide catalogue as requested by you our customers, so if your peptide isn’t listed, we can synthesise it for you and add it to our peptide inventory.
We can offer substantial discounts on larger quantities. For bulk amounts, request a quote online or email us at info@altabioscience.com.
PRODUCTS
-
CEF26, Influenza Virus NP (265-274)
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF026Sequence: ILRGSVAHKMolecular weight (g/mol): 980.17QuantityPriceQuantity1mg£115.00 -
CEF25, Influenza Virus NP (44-52)
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF025Sequence: CTELKLSDYMolecular weight (g/mol): 1071.2QuantityPriceQuantity1mg£115.00 -
CEF24, Influenza Virus PB1 Peptide (591-599)
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF024Sequence: VSDGGPNLYMolecular weight (g/mol): 920.96QuantityPriceQuantity1mg£115.00 -
CEF9, Influenza Virus M1 (128-135)
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF009Sequence: ASCMGLIYMolecular weight (g/mol): 857.05QuantityPriceQuantity1mg£115.00 -
CEF8, Influenza Virus NP (383-391)
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF008Sequence: SRYWAIRTRMolecular weight (g/mol): 1208.37QuantityPriceQuantity1mg£115.00 -
CEF7, Influenza Virus NP (380-388)
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF007Sequence: ELRSRYWAIMolecular weight (g/mol): 1193.35QuantityPriceQuantity1mg£115.00 -
CEF6, Influenza Virus NP
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF006Sequence: LPFDKTTVMMolecular weight (g/mol): 1051.26QuantityPriceQuantity1mg£115.00 -
CEF5, Influenza Virus NP (91-99)
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF005Sequence: KTGGPIYKRMolecular weight (g/mol): 1019.2QuantityPriceQuantity1mg£115.00 -
CEF4, Influenza Virus NP (342-351)
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF004Sequence: RVLSFIKGTKMolecular weight (g/mol): 1148.4QuantityPriceQuantity1mg£115.00 -
CEF3, Influenza Virus M1 (13-21)
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF003Sequence: SIIPSGPLKMolecular weight (g/mol): 911.1QuantityPriceQuantity1mg£115.00 -
CEF2, Influenza Virus PA (46-54)
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF002Sequence: FMYSDFHFIMolecular weight (g/mol): 1206.37QuantityPriceQuantity1mg£115.00 -
CEF1, Influenza Matrix Protein M1 (58-66)
Regular price £115.00 GBPRegular priceUnit price / perSale price £115.00 GBPCatalogue number: AB-CEF001Sequence: GILGFVFTLMolecular weight (g/mol): 966.17QuantityPriceQuantity1mg£115.00 -
β-Amyloid (1-40) human peptide
Regular price £250.00 GBPRegular priceUnit price / perSale price £250.00 GBPCatalogue number: BA01Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMolecular weight (g/mol): 4329.82QuantityPriceQuantity1mg£250.00
Additional information
As a trusted supplier of high-quality peptides, our online store makes purchasing a straightforward process meaning you can acquire peptides of exceptional quality with ease.
Every peptide in our collection undergoes rigorous quality control including mass spec and HPLC purity assessment, to ensure you receive peptides of the highest quality and at great value. Amino acid analysis can also be provided if required.
At AltaBioscience, we prioritise customer satisfaction. Should you require any assistance or have queries about specific peptides, our team of peptide chemists are available to provide expert guidance.
We also provide a custom peptide synthesis service from our ISO 9001-certified laboratory.
Get in touch at +44 (0) 1527 584495 or email us at info@altabioscience.com.
Join our community of satisfied customers who have come to rely on our expertise, product quality and exceptional customer service.