β-Amyloid (1-40) human peptide
β-Amyloid (1-40) human peptide
β-Amyloid (1-40) is a synthetic human peptide comprising the first 40 amino acids of the β-amyloid precursor protein. It plays a crucial role in neurodegenerative disease research, particularly in studying Alzheimer's disease. This peptide is instrumental in investigating amyloid plaque formation, aggregation, and cytotoxicity.
Formula | C194H295N53O58S |
Molecular weight (g/mol) | 4329.82 |
CAS number | 131438-79-4 |
Catalogue number | BA01 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
For larger quantities or bulk orders, please request a quote
Couldn't load pickup availability
- Description
- Technical Data
- References
β-Amyloid (1-40) is a synthetic human peptide comprising the first 40 amino acids of the β-amyloid precursor protein. It plays a crucial role in neurodegenerative disease research, particularly in studying Alzheimer's disease. This peptide is instrumental in investigating amyloid plaque formation, aggregation, and cytotoxicity.
Formula | C194H295N53O58S |
Molecular weight (g/mol) | 4329.82 |
CAS number | 131438-79-4 |
Catalogue number | BA01 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
