LL 37 (human)
LL 37 (human)
LL 37 is a cell permeable antimicrobial antiviral peptide derivative of human cathelicidin. It is active in regulating inflammation and neutralize lipopolysaccharides from Gram-negative bacteria.
Supplied lyophilised with analytical data.
| Formula | C205H340N60O53 |
| Molecular weight (g/mol) | 4493.32 |
| CAS number | 154947-66-7 |
| Catalogue number | LL37001 |
| Sequence | [LL-37, 37 aa] |
Regular price
$193.00 USD
Regular price
Sale price
$193.00 USD
Unit price
per
Shipping calculated at checkout.
For larger quantities or bulk orders, please request a quote
Couldn't load pickup availability
