LL-37 (human)
LL-37 (human)
LL-37 is a cell-permeable antimicrobial antiviral peptide derivative of human cathelicidin. It is active in regulating inflammation and neutralising lipopolysaccharides from Gram-negative bacteria.
Supplied lyophilised with analytical data.
Formula | C205H340N60O53 |
Molecular weight (g/mol) | 4493.32 |
CAS number | 154947-66-7 |
Catalogue number | LL37001 |
Sequence | [LL-37, 37 aa] |
Regular price
£150.00 GBP
Regular price
Sale price
£150.00 GBP
Unit price
per
For larger quantities or bulk orders, please request a quote