Collection: Catalogue peptides
Purified peptides ready to ship worldwide from our UK ISO 9001 certified laboratory.
Supplied lyophilised in amounts ranging from 0.5mg to 5mg at > 95% purity with HPLC and mass spec chromatograms.
Our bioactive peptides include histone peptides and arrays, Epstein-Barr virus peptides (EBVs), Influenza peptides, Cytomegalovirus peptides (CMV), cell-penetrating peptides (CPPs), and many others used in different applications such as HIV, diabetes and cancer research.
We are constantly adding to our extensive peptide catalogue as requested by you our customers, so if your peptide isn’t listed, we can synthesise it for you and add it to our peptide inventory.
We can offer substantial discounts on larger quantities. For bulk amounts, request a quote online or email us at info@altabioscience.com.
PRODUCTS
-
Fluorescein TAT-Cys amide peptide
Regular price $192.00 USDRegular priceUnit price / perSale price $192.00 USDCatalogue number: AB-CPP01Sequence: FAM–GGGGYGRKKRRQRRRGC-amideQuantityPriceQuantity1mg$192.00 -
LL-37 (human)
Regular price From $206.00 USDRegular priceUnit price / perSale price From $206.00 USDCatalogue number: LL37001Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESMolecular weight (g/mol): 4493.32QuantityPriceQuantity1mg$206.005mg$814.00 -
Lixisenatide
Regular price From $130.00 USDRegular priceUnit price / perSale price From $130.00 USDCatalogue number: SP008Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2Molecular weight (g/mol): 4858.0QuantityPriceQuantity1mg$130.005mg$281.00 -
Exendin-4 (Exenatide)
Regular price From $76.00 USDRegular priceUnit price / perSale price From $76.00 USDCatalogue number: SP007Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2Molecular weight (g/mol): 4187.0QuantityPriceQuantity1mg$76.005mg$203.00 -
Calcitonin, Human
Regular price From $165.00 USDRegular priceUnit price / perSale price From $165.00 USDCatalogue number: SP006Sequence: *CGNLST*CMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 *S-S Disulphide bridgeMolecular weight (g/mol): 3418.0QuantityPriceQuantity1mg$165.005mg$326.00 -
PR3 FRET Substrate Abz‐VAD‐norV‐ADRQ‐EDDnp
Regular price From $308.00 USDRegular priceUnit price / perSale price From $308.00 USDCatalogue number: SP004Sequence: Abz‐VAD‐norV‐ADRQ‐EDDnpMolecular weight (g/mol): 1285.3QuantityPriceQuantity1mg$308.005mg$1,224.00 -
KRRRAL-pS-VASLPGL (CK1 Substrate)
Regular price $324.00 USDRegular priceUnit price / perSale price $324.00 USDCatalogue number: SP003Sequence: KRRRAL-pS-VASLPGLMolecular weight (g/mol): 1603.9QuantityPriceQuantity1mg$324.00 -
G4RGDSP Peptide (4GRGDSP)
Regular price $178.00 USDRegular priceUnit price / perSale price $178.00 USDCatalogue number: SP002Sequence: GGGGRGDSPMolecular weight (g/mol): 758.7QuantityPriceQuantity25mg$178.00 -
GRGDSP Peptide
Regular price From $171.00 USDRegular priceUnit price / perSale price From $171.00 USDCatalogue number: SP001Sequence: GRGDSPMolecular weight (g/mol): 587.6QuantityPriceQuantity5mg$171.0025mg$404.00 -
Calcitonin, Salmon
Regular price From $124.00 USDRegular priceUnit price / perSale price From $124.00 USDCatalogue number: SP005Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPMolecular weight (g/mol): 3431.9QuantityPriceQuantity1mg$124.005mg$247.00 -
CEF20, Cytomegalovirus, CMV pp65 (495 - 503)
Regular price $158.00 USDRegular priceUnit price / perSale price $158.00 USDCatalogue number: AB-CEF020Sequence: NLVPMVATVMolecular weight (g/mol): 943.16QuantityPriceQuantity1mg$158.00 -
CEF10, Epstein-Barr Virus LMP2 Protein (426-434)
Regular price $158.00 USDRegular priceUnit price / perSale price $158.00 USDCatalogue number: AB-CEF010Sequence: CLGGLLTMVMolecular weight (g/mol): 906.17QuantityPriceQuantity1mg$158.00
Additional information
As a trusted supplier of high-quality peptides, our online store makes purchasing a straightforward process meaning you can acquire peptides of exceptional quality with ease.
Every peptide in our collection undergoes rigorous quality control including mass spec and HPLC purity assessment, to ensure you receive peptides of the highest quality and at great value. Amino acid analysis can also be provided if required.
At AltaBioscience, we prioritise customer satisfaction. Should you require any assistance or have queries about specific peptides, our team of peptide chemists are available to provide expert guidance.
We also provide a custom peptide synthesis service from our ISO 9001-certified laboratory.
Get in touch at +44 (0) 1527 584495 or email us at info@altabioscience.com.
Join our community of satisfied customers who have come to rely on our expertise, product quality and exceptional customer service.